Van binnenuit bekeken

Een medewerker die al vele jaren voor Polyvision werkt, deelt zijn ervaringen en ideeën over wat Polyvision heeft gemaakt tot het bedrijf dat het nu is.

Edward La Selva, algemeen directeur voor ontwikkeling van bouwkundige producten en aangepaste producten bij Polyvision.

Bijna veertig jaar geleden ging Edward La Selva in plaats van zijn broer naar een sollicitatiegesprek voor een verkoopfunctie en sindsdien bouwt hij aan zijn kennis van CeramicSteel. Als een veelzijdige persoon in de bedrijfstak vervulde La Selva vele rollen met allerlei verantwoordelijkheden en is hij nu algemeen directeur voor ontwikkeling van bouwkundige producten en aangepaste producten bij Polyvision. We hebben met La Selva gepraat over de geschiedenis van Polyvision, zijn persoonlijke ervaringen met het bedrijf en de toekomst.

PV: Wat wilde u graag worden als kind?

ELS: Ik droomde er altijd van eigenaar van een bouwbedrijf te zijn.

PV: Wat is nu uw droombaan?

ELS: Ik denk mijn huidige werkzaamheden bij Polyvision. Ik heb het bedrijf enige tijd verlaten vanwege andere interesses en ben teruggekeerd. Ik heb veel geleerd over wat een droombaan voor mij betekent.

PV: Wat bevalt u het meest aan werken voor Polyvision?

ELS: We hebben een product met unieke eigenschappen en voordelen dat door maar weinigen in de wereld kan worden nagemaakt. Het product is uitzonderlijk en werken voor een dergelijk gespecialiseerd bedrijf is dat ook. Maar wat mij het meest bevalt is het feit dat de mensen die hier werken Polyvision's belangrijkste bezit zijn en deze gedachte zijn weerslag vindt in de bedrijfscultuur die Polyvision voorstaat. Mensen komen op de eerste plaats, altijd.

Derde verdieping van metrostation Den Haag Centraal met glazen ramen en wandpanelen van Standard CeramicSteel.

PV: Dus u begon in deze bedrijfstak door in plaats van uw broer naar een sollicitatiegesprek te gaan. Vertel ons eens wat meer over de CeramicSteel-bedrijven waarvoor u hebt gewerkt en waarom Polyvision deze overnam?

ELS: AllianceWall werd opgericht in 1963 in Alliance, Ohio door de familie die grondlegger was van The Caloric Stove Company. Zij vervaardigden dunwandige CeramicSteel voor bouwkundige wandbekleding. Terwijl het bedrijf groeide, ontdekten ze dat de unieke eigenschappen van het CeramicSteel-oppervlak voor andere toepassingen te gebruiken was, vooral als een ideaal oppervlak voor droog-wisbare markerboards en zelfs krijtborden. De vestiging in Ohio werd uiteindelijk gesloten en verhuisde naar Oklahoma, terwijl een tweede productiefaciliteit werd geopend in België, allemaal met de intentie CeramicSteel wereldwijd te gaan leveren. Polyvision nam het bedrijf in de herfst van 1998 over om te voorzien in zowel statische als interactieve communicatie- en educatietools.

Een Motif-samenwerkingspanelensysteem van Polyvision geïnstalleerd in een samenwerkingsruimte van een kantoor.

PV: Sindsdien heeft Polyvision vele producten en mogelijkheden ontwikkeld. Wat is volgens u Polyvision's grootste mijlpaal ooit?

ELS: Eenvoudig CeramicSteel weer relevant maken als een vooraanstaand, veelzijdig oppervlak. Ons product wordt wereldwijd gebruikt in een breed scala aan verschillende toepassingen, en dat komt omdat het product zo veelzijdig is. Het kan worden gebruikt in luchthavens, scholen, metrostations, tunnels; de toepassingsmogelijkheden zijn oneindig.

PV: Polyvision is wereldwijd toonaangevend voor CeramicSteel. Wat is uw favoriete project of plaats waar u voor het bedrijf naartoe bent gereisd, en waarom?

ELS: Er zijn er te veel om er slechts één op te noemen. Mijn top vijf projecten en plaatsen zijn:

  1. Ted Williams-tunnel: Boston, MA - 750.000 vierkante voet CeramicSteel. Groter dan dit bestaat niet.
  2. Shriners Hospital: Lexington, KY - geweldige afbeeldingen in een ziekenhuis dat kinderen met een levensbedreigende ziekte behandelt. De vertegenwoordigers van Shriners kregen tranen in hun ogen toen ze uit de lift kwamen en de Polyvision CeramicSteel-panelen zagen waarop de geschiedenis van de organisatie tot uitdrukking is gebracht.
  3. Google: Boulder, CO – Sans™  en Flow™ producten overal in een gebouw waarvan het interieurontwerp progressief en uniek moest zijn.
  4. Trainingscenter van American Airlines: Dallas, TX - Soms heb je een project waarvan je pas als het klaar is, weet hoe het eruitziet.
  5. Forensentreinstation Arvada Ridge: Arvada, CO - geweldige afbeeldingen in een unieke toepassing van CeramicSteel.

Een trein passeert de muurschildering Chromatic Harvest in lightrailstation Arvada Ridge

PV: Er zijn zoveel verschillende toepassingen. Waarom denkt u dat Polyvision-producten de beste keus zijn voor klanten?

ELS: Mensen hebben behoefte aan producten die esthetisch aantrekkelijk en functioneel zijn. Esthetiek, duurzaamheid en functionaliteit zijn gecombineerd in één product, dat, zoals ik eerder zei, weinigen in de wereld kunnen namaken. Ook zijn er waarschijnlijk niet veel Polyvision CeramicSteel-producten op een stortplaats te vinden. Een samenwerkingsafwerking met levenslange garantie heeft nou eenmaal geen geplande veroudering. De afwerking en producten zijn er altijd op gemaakt om de tand des tijds te doorstaan.

PV: Productinnovaties zijn van groot belang voor het succes van Polyvision. Wat is volgens u het beste voorbeeld van innovatie door het bedrijf?

ELS: Ik zou zeggen onze introductie van de technologie voor digitale afbeeldingen en ons pakket aan samenwerkingsproducten. Technologie heeft onze ontwikkeling gestimuleerd, maar als je erover nadenkt, geven we mensen een onderbreking van technologie door ze de mogelijkheid van interactie met hun omgeving te bieden. Of het nu door een treinstation lopen is en stilstaan om een prachtige CeramicSteel-muurschildering te bekijken of het houden van een productieve samenwerkingssessie met behulp van een markerboard om ideeën vast te leggen en het creatieve proces te stimuleren.

Met Polyvision's panelen met afgewerkte rand worden kunstwerken van Thierry Renard getoond in metrostation Sainte Catherine in Brussel, België.

PV: Hoe ziet de toekomst eruit voor Polyvision? Waar zullen de bedrijfsinspanningen de komende jaren op gericht zijn?

ELS: Ik denk dat er drie zeer belangrijke dingen te gebeuren staan. Ten eerste zullen we de bekendheid met CeramicSteel blijven vergroten door de nieuwste generatie architecten en ontwerpers te informeren over de kenmerken en voordelen ervan. Ten tweede zullen we onze missie voortzetten om nieuwe producten te introduceren die zowel esthetisch aantrekkelijk als uiterst functioneel zijn. En ten derde zullen we relevant blijven door nieuwe markten, toepassingen en gebruiksmanieren voor ons oppervlak te vinden.

PV: Tot slot, op welk moment in uw werk voor Polyvision bent u het meest trots?

ELS: De succesvolle introductie van onze nieuwe lijn samenwerkingsproducten. Dat was een opeenstapeling van hard werken, doorzetten en teamwork van velen!

PV: Heel erg bedankt voor de tijd en inzichten, Ed!

ELS: Dank u wel!


  1. Bob Crain says:

    March 28th, 2019 at 4:26 PM

    Great article Ed. I hope your insight and perspective will enable others to benefit from the great products PolyVision offers and the varied applications it will support.

  2. Dennis Guidera says:

    March 28th, 2019 at 10:09 PM

    Great interview and summary. You are truly the “company historian” having lived through all that growth. Our team is fortunate to have your depth of experience. I know you bailed me out of some technical situations over the years.
    Thanks for everything you do.

  3. Steve Eriksson says:

    April 10th, 2019 at 11:40 AM

    Was great working with you one of the last projects before I retired, where we started by filling three walls of (PolyVision) marker board with potential order flow and data transformation diagrams. You are a critical part of both the generation and, (especially), the implementation of very cool product and manufacturing ideas at PolyVision. Wishing you all the best, Ed!

Leave a Response