Van binnenuit bekeken


A longtime Polyvision employee shares his experience and insights on what made Polyvision the company it is today.

Edward La Selva, algemeen directeur voor ontwikkeling van bouwkundige producten en aangepaste producten bij PolyVision.

Bijna veertig jaar geleden ging Edward La Selva in plaats van zijn broer naar een sollicitatiegesprek voor een verkoopfunctie en sindsdien bouwt hij aan zijn kennis van CeramicSteel. A hybrid in the industry, La Selva has had numerous roles stretching a range of responsibilities and is now the global manager of architectural product development and custom products for Polyvision. We hebben met La Selva gepraat over de history of Polyvision, zijn persoonlijke ervaringen met het bedrijf en de toekomst.

PV: Wat wilde u graag worden als kind?

ELS: Ik droomde er altijd van eigenaar van een bouwbedrijf te zijn.

PV: Wat is nu uw droombaan?

ELS: I would say what I'm doing for Polyvision right now is it. Ik heb het bedrijf enige tijd verlaten vanwege andere interesses en ben teruggekeerd. Ik heb veel geleerd over wat een droombaan voor mij betekent.

PV: What do you love most about working for Polyvision?

ELS: We hebben een product met unieke eigenschappen en voordelen dat door maar weinigen in de wereld kan worden nagemaakt. Het product is uitzonderlijk en werken voor een dergelijk gespecialiseerd bedrijf is dat ook. But, what I really love is the fact that the people that work here are Polyvision's most important asset and this mindset is reflected in the culture that Polyvision curates. Mensen komen op de eerste plaats, altijd.

Derde verdieping van metrostation Den Haag Centraal met glazen ramen en wandpanelen van Standard CeramicSteel.

PV: Dus u begon in deze bedrijfstak door in plaats van uw broer naar een sollicitatiegesprek te gaan. Tell us a little more about the CeramicSteel companies you worked for and why did Polyvision acquire it?

ELS: AllianceWall werd opgericht in 1963 in Alliance, Ohio door de familie die grondlegger was van The Caloric Stove Company. Zij vervaardigden dunwandige CeramicSteel voor bouwkundige wandbekleding. Terwijl het bedrijf groeide, ontdekten ze dat de unieke eigenschappen van het CeramicSteel-oppervlak voor andere toepassingen te gebruiken was, vooral als een ideaal oppervlak voor droog-wisbare markerboards en zelfs krijtborden. De vestiging in Ohio werd uiteindelijk gesloten en verhuisde naar Oklahoma, terwijl een tweede productiefaciliteit werd geopend in België, allemaal met de intentie CeramicSteel wereldwijd te gaan leveren. Polyvision acquired the company in the Fall of 1998 to supply both static and interactive communication and learning tools.

Een Motif-samenwerkingspanelensysteem van PolyVision geïnstalleerd in een samenwerkingsruimte van een kantoor.

PV: Since that time, Polyvision has developed numerous products and capabilities. What do you think is Polyvision's greatest milestone throughout the years?

ELS: Eenvoudig CeramicSteel weer relevant maken als een vooraanstaand, veelzijdig oppervlak. Ons product wordt wereldwijd gebruikt in een breed scala aan verschillende toepassingen, en dat komt omdat het product zo veelzijdig is. Het kan worden gebruikt in luchthavens, scholen, metrostations, tunnels; de toepassingsmogelijkheden zijn oneindig.

PV: Polyvision is a worldwide leader for CeramicSteel. Wat is uw favoriete project of plaats waar u voor het bedrijf naartoe bent gereisd, en waarom?

ELS: Er zijn er te veel om er slechts één op te noemen. Mijn top vijf projecten en plaatsen zijn:

  1. Ted Williams-tunnel: Boston, MA - 750.000 vierkante voet CeramicSteel. Groter dan dit bestaat niet.
  2. Shriners Hospital: Lexington, KY - geweldige afbeeldingen in een ziekenhuis dat kinderen met een levensbedreigende ziekte behandelt. The Shriners representatives cried when they got off the elevator and saw the Polyvision CeramicSteel imaged panels depicting the history of the organization.
  3. Google: Boulder, CO – Sans™  en Flow™ producten overal in een gebouw waarvan het interieurontwerp progressief en uniek moest zijn.
  4. Trainingscenter van American Airlines: Dallas, TX - Soms heb je een project waarvan je pas als het klaar is, weet hoe het eruitziet.
  5. Forensentreinstation Arvada Ridge: Arvada, CO - geweldige afbeeldingen in een unieke toepassing van CeramicSteel.

Een trein passeert de muurschildering Chromatic Harvest in lightrailstation Arvada Ridge

PV: With so many different applications, why do you think Polyvision products are the top choice for customers?

ELS: Mensen hebben behoefte aan producten die esthetisch aantrekkelijk en functioneel zijn. Esthetiek, duurzaamheid en functionaliteit zijn gecombineerd in één product, dat, zoals ik eerder zei, weinigen in de wereld kunnen namaken. Also, you're probably not going to find many Polyvision CeramicSteel products in landfills. Een samenwerkingsafwerking met levenslange garantie heeft nou eenmaal geen geplande veroudering. De afwerking en producten zijn er altijd op gemaakt om de tand des tijds te doorstaan.

PV: Product innovations are key to Polyvision’s success, what do you think is the best example of innovation for the company?

ELS: Ik zou zeggen onze introductie van de technologie voor digitale afbeeldingen en ons pakket aan samenwerkingsproducten. Technologie heeft onze ontwikkeling gestimuleerd, maar als je erover nadenkt, geven we mensen een onderbreking van technologie door ze de mogelijkheid van interactie met hun omgeving te bieden. Of het nu door een treinstation lopen is en stilstaan om een prachtige CeramicSteel-muurschildering te bekijken of het houden van een productieve samenwerkingssessie met behulp van een markerboard om ideeën vast te leggen en het creatieve proces te stimuleren.

Met PolyVision's panelen met afgewerkte rand worden kunstwerken van Thierry Renard getoond in metrostation Sainte Catherine in Brussel, België.

PV: What is on the horizon for Polyvision? Waar zullen de bedrijfsinspanningen de komende jaren op gericht zijn?

ELS: Ik denk dat er drie zeer belangrijke dingen te gebeuren staan. Ten eerste zullen we de bekendheid met CeramicSteel blijven vergroten door de nieuwste generatie architecten en ontwerpers te informeren over de kenmerken en voordelen ervan. Ten tweede zullen we onze missie voortzetten om nieuwe producten te introduceren die zowel esthetisch aantrekkelijk als uiterst functioneel zijn. En ten derde zullen we relevant blijven door nieuwe markten, toepassingen en gebruiksmanieren voor ons oppervlak te vinden.

PV: To wrap up, tell us about your proudest moment working for Polyvision?

ELS: De succesvolle introductie van onze nieuwe lijn samenwerkingsproducten. Dat was een opeenstapeling van hard werken, doorzetten en teamwork van velen!

PV: Heel erg bedankt voor de tijd en inzichten, Ed!

ELS: Dank u wel!

Responses


  1. Bob Crain says:

    March 28th, 2019 at 4:26 PM

    Great article Ed. I hope your insight and perspective will enable others to benefit from the great products PolyVision offers and the varied applications it will support.


  2. Dennis Guidera says:

    March 28th, 2019 at 10:09 PM

    Great interview and summary. You are truly the “company historian” having lived through all that growth. Our team is fortunate to have your depth of experience. I know you bailed me out of some technical situations over the years.
    Thanks for everything you do.


  3. Steve Eriksson says:

    April 10th, 2019 at 11:40 AM

    Was great working with you one of the last projects before I retired, where we started by filling three walls of (PolyVision) marker board with potential order flow and data transformation diagrams. You are a critical part of both the generation and, (especially), the implementation of very cool product and manufacturing ideas at PolyVision. Wishing you all the best, Ed!


Leave a Response